SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SV47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SV47
Domain Number 1 Region: 429-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-18
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 137-182
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000575
Family KRAB domain (Kruppel-associated box) 0.0032
Further Details:      
 
Domain Number 3 Region: 314-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000683
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 367-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000467
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  G1SV47
Domain Number - Region: 47-116
Classification Level Classification E-value
Superfamily Tropomyosin 0.00111
Family Tropomyosin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1SV47
Sequence length 496
Comment (tr|G1SV47|G1SV47_RABIT) Zinc finger protein 212 {ECO:0000313|Ensembl:ENSOCUP00000007278} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=ZNF212 OC=Oryctolagus.
Sequence
MAESAPARHRRKRRSTPLTSSTPPSQATEKSSYFQTTEISLWTVVAALQAVEKKMESQAA
RLQSLEGRAGTAEKKLADCEKTAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRN
RNFWVLRLPPGSKGEAPKMSRSLENDGVCFTEQEWENLEDWQKELYRNVMQSNYETLVSL
KVLGQPEGEAELGTEMLGDLEEEGPGGAHPPDGIVLRQELQYQQEGSADLPGEFSGVAEE
QAFLNPEQTELWDGQGGSVFLESGPGDSNLEEPVGSRDPSSGRILGCPPKQKYRRQVQLG
QECGQGLKLKRDASGPYQCSECELSFRYKQQLATHLRSHSGWESYTAAEPVESLRPRPRL
KPQSKKAKLHQCDVCLRSFSCRVSLVTHQRCHLQEGPSASQYIQERFSPNSLVALPGHIP
WRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYRCTECEKSFVQKQHLLQHQKIHQR
ERGGLALESGRPNGLL
Download sequence
Identical sequences G1SV47
XP_008256273.1.1745 ENSOCUP00000007278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]