SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SX67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SX67
Domain Number 1 Region: 526-847
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.05e-109
Family PDEase 0.0000000000136
Further Details:      
 
Domain Number 2 Region: 137-331
Classification Level Classification E-value
Superfamily GAF domain-like 1.09e-44
Family GAF domain 0.0000786
Further Details:      
 
Domain Number 3 Region: 317-521
Classification Level Classification E-value
Superfamily GAF domain-like 4.36e-38
Family GAF domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1SX67
Sequence length 865
Comment (tr|G1SX67|G1SX67_RABIT) Phosphodiesterase {ECO:0000256|RuleBase:RU363067} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=PDE5A OC=Oryctolagus.
Sequence
MEPAGPSPGRPQQQRDTDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKE
GVRGHPESCSCPLQQTPRADSSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEK
KEQMPLTPPRFEHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLV
CEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAALGEPLNIKDAYEDPR
FNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFC
GIVLHNAQLYETSLLENRRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIF
IVDEDCSDSFSSVFHMECEELEKSSDTLTRERDSNKINYMYAQYVKNTMEPLNIPDVSKD
KRFPWTSENTGNINQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVKPFNRNDEQ
FLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPS
AQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNV
AYHNWRHAFNTAQCMFAALKSGKIQNKLTDLEILALLIAALSHDLDHRGVNNSYIQRSEH
PLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTALKIIKQAILATDLALYIK
RRGEFFELIRKNQFDVEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQG
DRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNR
QKWQALAEQQEKMLINGESNQAKRN
Download sequence
Identical sequences G1SX67
XP_002717273.1.1745 9986.ENSOCUP00000008127 ENSOCUP00000008127 ENSOCUP00000008127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]