SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1SX78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SX78
Domain Number 1 Region: 44-157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-27
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 252-369
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000275
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 455-492
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 4 Region: 165-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 211-250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 416-453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  G1SX78
Domain Number - Region: 388-415
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0034
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1SX78
Sequence length 756
Comment (tr|G1SX78|G1SX78_RABIT) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSOCUP00000008140} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=LRP3 OC=Oryctolagus.
Sequence
CPGTPATGPKSKSHASSTDPSVSPTVNIFLTGKLSSAGPALAACSGKLEQHTERRGVIYS
PAWPLNYPAGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRL
CGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQTSCQADEFRCDNGKCL
PGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGTQD
CGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLE
LRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFN
ATYQVKGYCLPWEQPCGGSGEGDGGDTGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPD
QYPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCATNLCIFETWRCDGQED
CQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTR
LEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHALWNRL
FHRPRAPRGQIPLLTAARTSQTVLGDGLVQPAPGAAPAPRTDTGSPRAASDGAPSAPGHA
PEGGPPGPVPASSLRDPECRPVDKDRKARRDPPVDSSAPADTPREPCSAQDPQPQAPTAS
STLGSHPPEPLGVCRSPPPPCSPTSEASDDEALLVC
Download sequence
Identical sequences G1SX78
9986.ENSOCUP00000008140 ENSOCUP00000008140 ENSOCUP00000008140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]