SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1T3S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1T3S0
Domain Number 1 Region: 538-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.63e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1T3S0
Sequence length 780
Comment (tr|G1T3S0|G1T3S0_RABIT) Solute carrier family 26 member 4 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=SLC26A4 OC=Oryctolagus.
Sequence
MAAPGNRSEPPQQLPEYNCSYVVSRPVYSELAFQQKHERRLQERKTLRESLAKSCSCSRK
RAFGVLKALLPILEWLPKYRVKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPLGYGLYS
AFFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLNMAPDEHFLIPGNGTTSNTTVVDSVA
RDAERVLVASALSLLVGIIQLILGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQVKIVL
NVSTKNYNGVLSIIYTLIEIFQNIRDTNIADLIAGLLTIVICMAVKEINDRFKHKIPVPI
PIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPSLPPVSLFSKMLAESFSIAVVA
YAIAVSVGKVYATKYDYTIDGNQEFIAFGISNIFSGCFSCFVATTALSRTAVQESTGGKT
QVAGIISAGIVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWRQNKVDAV
IWVFTCVVSIILGLDLGLLAGLVFALFTVVLRVQFPSWNSLGSIPSTDIYKSTKDYKNIE
EPEGVKILRYSSPIFYANVDGFKKCIKSTVGFDAIRVYNKRLKALRRIQKLIKKGQLRAT
KNGIISDAGSPNAAFETDEDIEDLEELDVPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAISFLDVVGVRSLRVIVKEFQRINVNVYFASLQDHVMEKLEHCGFFDDHHRKDTFFL
TVHDAILYLQNQVKSTKGEDSILETINLIQDCKDPLELMDAELAEEELDVQDEAMRRLAS
Download sequence
Identical sequences G1T3S0
ENSOCUP00000010879 ENSOCUP00000010879 XP_002712085.1.1745 9986.ENSOCUP00000010879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]