SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1T452 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1T452
Domain Number 1 Region: 4-443,555-610
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-78
Family GDI-like N domain 0.000000000000497
Further Details:      
 
Domain Number 2 Region: 443-554
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.26e-40
Family GDI-like 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1T452
Sequence length 648
Comment (tr|G1T452|G1T452_RABIT) CHM, Rab escort protein 1 {ECO:0000313|Ensembl:ENSOCUP00000011031} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=CHM OC=Oryctolagus.
Sequence
MADNLPSEFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRNYYGGNWASFSFSGLLSWIK
EYQENGDTTNESSRWQEQVLENEEAIGLSKKDKTIQHVEVFCYASQDLHEDVEEAGALQK
NHASVTSANSTEAADSACLPTEDESLSIVSCEMSAEQTPSSDPESAPEVNDAEATGEKGD
HCDDKTSEEETSTNVPTAADTIEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDL
LIKSNVSRYAEFKNITRILAFREGRVEQVPCSRADVFNSKQLSMVEKRMLMKFLTFCMEY
EEHPDEYKGYEEIAFSEYLKTQKLTPNLQYFVLHSIAMTSETTTTTLDGLKATKNFLHCL
GRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAIIDQFGQ
RIMSTHFLVEDSYLSENMCSHVQYRQISRAVLITDRSVLKTDSDQQISILTVPAEEPGTS
AVRVIELCSSTMTCMKGTYLVHLTCTSSKTARDDLEPVVQKLFTPFTEMEIEKEEVEKPR
ILWALYFNMRDSSDIDRNCYKDLPSNVYVCSGPDCALGNDNAVKQAETLFQQIYPNEDFC
PPPPNPEDIILDGDSSQPGASESIAIPEANSETPEESANLENPQAPSE
Download sequence
Identical sequences G1T452
ENSOCUP00000011031 XP_008271215.1.1745 ENSOCUP00000011031 9986.ENSOCUP00000011031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]