SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1T511 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1T511
Domain Number 1 Region: 331-398
Classification Level Classification E-value
Superfamily FF domain 0.0000000000000183
Family FF domain 0.0000286
Further Details:      
 
Domain Number 2 Region: 145-179
Classification Level Classification E-value
Superfamily WW domain 0.00000000000264
Family WW domain 0.00033
Further Details:      
 
Domain Number 3 Region: 470-539
Classification Level Classification E-value
Superfamily FF domain 0.000000000196
Family FF domain 0.0058
Further Details:      
 
Domain Number 4 Region: 176-214
Classification Level Classification E-value
Superfamily WW domain 0.00000000114
Family WW domain 0.0015
Further Details:      
 
Domain Number 5 Region: 567-626
Classification Level Classification E-value
Superfamily FF domain 0.00000000693
Family FF domain 0.0043
Further Details:      
 
Domain Number 6 Region: 403-472
Classification Level Classification E-value
Superfamily FF domain 0.0000000222
Family FF domain 0.0041
Further Details:      
 
Domain Number 7 Region: 698-758
Classification Level Classification E-value
Superfamily FF domain 0.0000000406
Family FF domain 0.0000431
Further Details:      
 
Weak hits

Sequence:  G1T511
Domain Number - Region: 63-115
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1T511
Sequence length 910
Comment (tr|G1T511|G1T511_RABIT) Pre-mRNA processing factor 40 homolog A {ECO:0000313|Ensembl:ENSOCUP00000011402} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=PRPF40A OC=Oryctolagus.
Sequence
MRPGTGAERGGLMVSEMENQPPSRGPGDGEPRLSGSNLCSSSWVSADGFLRRRPSMGHPG
MHYAPMGMHPMGQRANMPPVPHGMMPQMMPPMGGPPMGQMPGMMSSVMPGMMMSHMSQAS
MQPALPPGVNSMDVAAGTASGAKSMWTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQ
LLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELEDLEGYQNTIVAGGLITKSNLHAMI
KAEESSIVSKEECTTTSAAPVPTTEIPTTMSPVDNENTVTISTEEQAQLTSTSAIQDQSV
EVSSNTGEETSKQETVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKMASSRG
PSNASWERAIKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQR
FLENHDKMTSTTRYKKAEQMFGEMEVWNAISERDRLEIYEDVLFFLSKKEKEQAKQLRKR
NWEALKNILDNMANVTYSTTWSEAQQYLMDNPTFAEDEELQNMDKEDALICFEEHIRALS
GFPEDYFEKSLSRENHQKRLFRYFFSQIFLDELHEHGQLHSMSSWMELYPTISSDIRFTN
MLGQPGSTALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFVAIISSTKR
STTLDAGNIKLAFNSSQYLQKARGRDREREKESRKMKRKEFCFPRVCEQAAPPIELDAVW
EDIRERFVKEPAFEDITLESERKRIFKDFMHVLEHECQHHHSKNKKHSKKSKKHHRKRSR
SRSGSDSDDDDSHSKKKRQRSESRSASEHSSSAESERSYKKSKKHKKKSKKRRHKSDSAE
SDAEREKDKKEKDRESEKDRTRQRSESKHKSPKKKTGKDSGNWDTSGSELSEGELEKRRR
TLLEQLDDDQ
Download sequence
Identical sequences G1T511
9986.ENSOCUP00000011402 ENSOCUP00000011402 ENSOCUP00000011402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]