SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1T6B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1T6B8
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 8.31e-55
Family C-type lysozyme 0.000000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1T6B8
Sequence length 148
Comment (tr|G1T6B8|G1T6B8_RABIT) Lysozyme {ECO:0000256|SAAS:SAAS00814457} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=LYZF1 OC=Oryctolagus.
Sequence
MKALLILGLLLLSTTVQGKIYERCELARTLKKLGLDGYKGVSLANWMCLTKWESSYNTQA
TNYNPGDKSTDYGIFQINSRYWCNDGKTPRAVNACHIPCSDLLKDDITQAVACAKRVVSD
PQGIRAWVAWRNHCQSQDLTSYIQGCGV
Download sequence
Identical sequences G1T6B8
XP_002711370.1.1745 9986.ENSOCUP00000011947 ENSOCUP00000011947 ENSOCUP00000011947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]