SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1T782 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1T782
Domain Number 1 Region: 43-142,239-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.33e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1T782
Sequence length 450
Comment (tr|G1T782|G1T782_RABIT) Uncharacterized protein {ECO:0000313|Ensembl:ENSOCUP00000012334} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=SQRDL OC=Oryctolagus.
Sequence
MTPLVTVMSGPHARLFACLLRLGPQQVGSLQLHTGASCAARSHYEVLVLGGGSGGITMAA
RMKRKVGAENVAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKAKVAE
LNPDKNCIQTDNGKEISYKYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGTIFGVK
KYAEALEEIIQERNLTVNYKQNLIEVRADKQEAVFENLDKPGETQVFSYEMLHVTPPMSP
PDVLKTSPVADAAGWVDVDKETLQHKKYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SLIMKNQTPMKKYDGYTSCPLVTGYNSVILAEFDYTARPLETFPFDQSKERLSMYLMKAD
MMPFLYWNLMLRGYWGGPAFLRKLFHLGMS
Download sequence
Identical sequences G1T782
ENSOCUP00000012334 XP_002717932.1.1745 9986.ENSOCUP00000012334 ENSOCUP00000012334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]