SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1TGH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1TGH4
Domain Number 1 Region: 63-366,533-568
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.87e-51
Family FAD-linked reductases, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1TGH4
Sequence length 608
Comment (tr|G1TGH4|G1TGH4_RABIT) Retinol saturase {ECO:0000313|Ensembl:ENSOCUP00000016024} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=RETSAT OC=Oryctolagus.
Sequence
MWLWLVLLAVLLAGLRKVYLGLFAGSSPNPFSEDVKRPPAPLVTDREARKKVLRQVFSAS
QVPEKLDVVVIGSGIGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGIHY
IGRMQEGSTGRFILDQITEGQLDWAAMCSPFDIVVLEGPNGRKEFPMYSGEEAYIRGLKE
KFPQEEAAIDKYMKLVKVVSSGAIHAILLKFLPLPLAQLLSRCRLLIRFSPFLRASTQSL
AEVLQQLGVSPELHAVLSYIFPTYGVTPSHTTFAMHALLVDHYLKGGFYPRGGSSEIAFH
IIPVIERAGGAVLTKATVQSVLLDSAGKVCGVSVKKGPQLVNVYCPIVISSAGLFNTYEK
LLPEGARSLPGVRQQLRMVRPGLGMFSVFICLRGTKEELGLQSTNYYVYFDTDMDKAMER
YISLPREKAANHIPLLFIASPSAKDPTWEDRFPDRSTMIVLVPSAFKWFEEWQEEPKGKR
SRDYETLKSAFVEASMSVVMRLFPHLEGKVDSAIGGSPLTNQFYLAAPRGACYGADHDLG
RLHPHAMASLRAQSPIPNLYLTGQDIFTCGLMGALQGALLCSSAILKRNLYSDLKDLGSR
IQAQKKKN
Download sequence
Identical sequences G1TGH4
9986.ENSOCUP00000016024 ENSOCUP00000016024 ENSOCUP00000016024 XP_002709724.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]