SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1TJZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1TJZ5
Domain Number 1 Region: 538-629
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.45e-41
Family Small-conductance potassium channel 0.00000363
Further Details:      
 
Domain Number 2 Region: 407-579
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.29e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  G1TJZ5
Domain Number - Region: 41-192
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1TJZ5
Sequence length 725
Comment (tr|G1TJZ5|G1TJZ5_RABIT) Potassium calcium-activated channel subfamily N member 3 {ECO:0000313|Ensembl:ENSOCUP00000017276} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=KCNN3 OC=Oryctolagus.
Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQLPPPPVPPAAPQQPPGPSLQPQ
PPQLPQQQPPPPPPPSHPLSQLTQLQSQPVHPGLLHSSPTAFRAPTSGNSTATLHPSSRQ
GSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMK
PLSRLSASRRNLIEAEPEGQPLQLFSPSNPPEIVISSREDNHAQQTLLHHPNATHNHQHA
GPPASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW
GLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYI
SLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHS
KLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHD
QQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKL
ELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQ
AIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELSDRSEDLEKQIGSLESKLEHL
TASFHSLPLLIADALRQQQQQLLSAVLEARGVSVAVGTTHAPLSESPIGVSSTSFPTPYT
SSSSC
Download sequence
Identical sequences G1TJZ5
ENSOCUP00000017276 ENSOCUP00000017276 XP_002715501.1.1745 9986.ENSOCUP00000017276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]