SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1TNL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1TNL3
Domain Number 1 Region: 3-217
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.75e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 
Domain Number 2 Region: 160-334
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.47e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 
Domain Number 3 Region: 310-495
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000371
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1TNL3
Sequence length 541
Comment (tr|G1TNL3|G1TNL3_RABIT) Flavin-containing monooxygenase {ECO:0000256|RuleBase:RU361177} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=FMO1 OC=Oryctolagus.
Sequence
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLDYLKMYADRFDLLKCIQFKTTVFSITKCQDFN
VSGQWEVVTLHEGKQESAIFDAVMVCTGFLTNPHLPLGCFPGIKTFKGQYFHSRQYKHPD
IFKDKRVLVVGMGNSGTDIAVEASHVAKKVFLSTTGGAWVISRVFDSGYPWDMVFTTRFQ
NFIRNSLPTPIVTWLVAKKMNSWFNHANYGLVPKDRIQLKEPVLNDELPGRIITGKVFIR
PSIKEVKENSVVFGNAHNTPSEEPIDVIVFATGYTFAFPFLDESVVKVEDGQASLYKYIF
PAHLQKPTLAVIGLIKPLGSMLPTGETQARYTVQVFKGVIKLPPTSVMIKEVNERKENKH
NGHLLQKRGFHLWYALGYHAVHLRTFVPLLSSIYASKLQVLIYPCQSVKFQXFFGPYSPY
QFRLTGPGKWKGARNAIMTQWDRTFKVTKTRIVQESSSPFESLLKLFAVLALLVSVFLIF
L
Download sequence
Identical sequences G1TNL3
ENSOCUP00000018588 ENSOCUP00000018588 9986.ENSOCUP00000018588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]