SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1TQY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1TQY0
Domain Number 1 Region: 64-308,416-478
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.01e-40
Family FAD-linked reductases, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1TQY0
Sequence length 486
Comment (tr|G1TQY0|G1TQY0_RABIT) FAD dependent oxidoreductase domain containing 1 {ECO:0000313|Ensembl:ENSOCUP00000019427} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=FOXRED1 OC=Oryctolagus.
Sequence
MLRGVLQLGLGRGLLTRGLGSRGGGSTVDWDEKVSEVKKKIKSMLPGEICDPLYDTSHLP
PEQSDVVIVGGGVVGLSVAFWLKKLEKRRGAIRVLVVERDHTYAQASTGLSVGGIRQQFS
LPENVQLSLFSINFLRNINEYLAVVDAPPLDLQFNPSGYLLLASEKSASTLENNVKVQRQ
EGAKICLMSPEQLRNKFPWINTEGVALASYGMEDEGWFDPWSLLQGLRRKVQSMGVLFCQ
GEVTRFVSSSSRMETTSGEEIIMKRIREVHVKMDNSLEYQPVECAIVINAAGAWSGKIAE
LAGVGKGPPGTLQGTKLPVEPRKRYVYLWHCPQGPGLETPFVADTNGVYFRREGLGNNYL
GGRSPTEEEEPDPSNLEVDHDFFQEKVWPQLAQRVPAFENLKVRSSWAGYYDYNTFDQNG
VVGPHPLVVNMYFATGFSGHGLQHAPAVGRAVAEMVLEGHFQTIDMSPFLFSRFHLGEKV
LEQNIF
Download sequence
Identical sequences G1TQY0
ENSOCUP00000019427 XP_002708349.1.1745 ENSOCUP00000019427 9986.ENSOCUP00000019427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]