SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1TTY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1TTY2
Domain Number - Region: 46-100
Classification Level Classification E-value
Superfamily DEATH domain 0.00647
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1TTY2
Sequence length 188
Comment (tr|G1TTY2|G1TTY2_RABIT) Caspase recruitment domain family member 19 {ECO:0000313|Ensembl:ENSOCUP00000020505} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=CARD19 OC=Oryctolagus.
Sequence
SAPTCVPDQTYCDRLVQDTPFLTGRGRLSEQQVDRIILQLNRYYPQILTDKQAEKFRNPK
ASLRLRLCDLLSHLQHSGERDCQEFYRALYIHAQPLHGLLPSRQALQNSDCTELDWGRES
HELSDRGPMSFLAGLGLAAGLALLLYCCPPDSRGLPGARRLLGFSPVIVDRHVSRYLLAF
LADDLGGL
Download sequence
Identical sequences G1TTY2
ENSOCUP00000020505 ENSOCUP00000020505 9986.ENSOCUP00000020505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]