SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1TYE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1TYE5
Domain Number 1 Region: 129-207
Classification Level Classification E-value
Superfamily DEATH domain 0.000000412
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1TYE5
Sequence length 216
Comment (tr|G1TYE5|G1TYE5_RABIT) EDAR associated death domain {ECO:0000313|Ensembl:ENSOCUP00000022109} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=EDARADD OC=Oryctolagus.
Sequence
MGLRTTKQMGRGTKQPAGHQEDHMAKEPVEDTDPSTLSFNMSDKYPIQDTGLPKAEECDT
VTLNCPPNSDEQHQGEENGFPDSTGDPLSDVSKDKPCHENCTCSSCSLRAPTISDLLNDQ
DLLDVIRIKLDPCHPTVKNWRNFASKWGMPYDELCFLEQRPQSPTLEFLLRNSQRTVGQL
MELCRLYHRADVEKVLRRWVEEEWPKRERGDYSRHF
Download sequence
Identical sequences G1TYE5
XP_017203201.1.1745 ENSOCUP00000022109 ENSOCUP00000022109 9986.ENSOCUP00000022109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]