SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1TYJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1TYJ0
Domain Number 1 Region: 35-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 75-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 1-30
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1TYJ0
Sequence length 310
Comment (tr|G1TYJ0|G1TYJ0_RABIT) Low density lipoprotein receptor class A domain containing 3 {ECO:0000313|Ensembl:ENSOCUP00000022154} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=LDLRAD3 OC=Oryctolagus.
Sequence
MCSNGRCIPGAWQCDGLPDCFDKSDEKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFE
DCPDGSDEENCTANPLLCSTARYHCKNGLCIDKSFICDGQNNCQDNSDEESCESSQEPGS
GQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPV
LLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPP
PPYSSDTESLNQADLPPYRSRSGSADSASSQATSSLLSVDDTGHSPGQPGPPEDTPQSRD
AVPSQGTEDV
Download sequence
Identical sequences G1TYJ0
ENSOCUP00000022154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]