SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1U1N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1U1N0
Domain Number 1 Region: 35-136
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0073
Further Details:      
 
Domain Number 2 Region: 262-364
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000746
Family Scavenger receptor cysteine-rich (SRCR) domain 0.04
Further Details:      
 
Domain Number 3 Region: 166-263
Classification Level Classification E-value
Superfamily SRCR-like 0.000000379
Family Scavenger receptor cysteine-rich (SRCR) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1U1N0
Sequence length 488
Comment (tr|G1U1N0|G1U1N0_RABIT) T-cell surface glycoprotein CD5 precursor {ECO:0000313|Ensembl:ENSOCUP00000023266} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=CD5 OC=Oryctolagus.
Sequence
MGSQPPPLAAVSLLGMLVTSCLGWSSWDEPGFLANLTNSHSPCQGQLEVYTTGSWHTVCS
RSWGMNSEGWKDPWKASKLCQQLHCGEALAVGPFPHFNKPRNQLFCMGLPGSFANCSRIS
QCHSLGLVCLEPRKTTPPPTSPPPETTPQPTAPPRLQLVPGPRGLHCAGVVEFYRGSLGG
TICAEAQDKNEDLGKFVCATLQCGSLKEVTAVEAAGELGGRRPLPIRWGIQNASCTSLEQ
CFRRIQPQDGRRALALVCSDFQPKVQSRLVGGSSMCEGTAEVRQGPRWAALCHNSSAKGT
ARWEELCQEQQCGIVNSYYVLDTGKKAAWGFSCPQEKLSQCHELREKKANCKRVFVTCQD
PNPAGPAAGTVASIILALVLLAVLLVVCGPLAYRKLVKKFRQKKQRQWIGPTEMSQNMSF
HRNHTATTVRSQAGNPTASSHVDNEYSQPPRNSRLSAYPALEGALHRSSTQPDNSSDSDY
DLHAAQRL
Download sequence
Identical sequences G1U1N0
ENSOCUP00000023266 9986.ENSOCUP00000023266 ENSOCUP00000023266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]