SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1U7G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1U7G6
Domain Number 1 Region: 2-237,341-415
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.02e-71
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000631
Further Details:      
 
Domain Number 2 Region: 220-337
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.39e-39
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000692
Further Details:      
 
Domain Number 3 Region: 432-519
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.27e-26
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1U7G6
Sequence length 519
Comment (tr|G1U7G6|G1U7G6_RABIT) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial {ECO:0000256|RuleBase:RU362051} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=SDHA OC=Oryctolagus.
Sequence
GAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGS
DWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLKFGKGGQAHRCC
CVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAK
NTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEC
RGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHL
PPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQI
VPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVPPIKPNAGEE
SVMNLDKLRFADGSIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKISQLYGDLKHLKT
FDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRG
Download sequence
Identical sequences G1U7G6
ENSOCUP00000025370 ENSOCUP00000024200 9986.ENSOCUP00000025370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]