SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2HEI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2HEI7
Domain Number 1 Region: 291-344
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000486
Family UBA domain 0.013
Further Details:      
 
Domain Number 2 Region: 14-193
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000000916
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2HEI7
Sequence length 344
Comment (tr|G2HEI7|G2HEI7_PANTR) UBAC2 isoform 2 {ECO:0000313|EMBL:PNI56094.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0022539 OC=Catarrhini; Hominidae; Pan.
Sequence
MFTSTGSSGLYKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQIWRLICG
RIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLIEAMQYFFGI
TAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIW
IVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLD
IQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAA
PPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH
Download sequence
Identical sequences A0A024RE02 G2HEI7 Q8NBM4
ENSPTRP00000053400 NP_001137544.1.87134 NP_001137544.1.92137 NP_001233420.1.37143 ENSPTRP00000053400 9598.ENSPTRP00000053400 9606.ENSP00000383911 ENSP00000383911 gi|221316645|ref|NP_001137544.1| ENSP00000347928 ENSP00000383911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]