SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2HF49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2HF49
Domain Number 1 Region: 72-206,242-343
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.87e-59
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000686
Further Details:      
 
Domain Number 2 Region: 353-450
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 7.98e-27
Family Anticodon-binding domain of PheRS 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2HF49
Sequence length 451
Comment (tr|G2HF49|G2HF49_PANTR) Phenylalanyl-tRNA synthetase, mitochondrial {ECO:0000313|EMBL:BAK62357.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0017266 OC=Catarrhini; Hominidae; Pan.
Sequence
MVGSALRRGARAYVYLVSKASHISRGHQHQAWGSRPPAAECATQRAPGSVVELLGKSYPQ
DDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVV
TTWQNFDSLLIRADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRR
DQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGESLQLFEQSSRSAHKQETHTMEAVKLVE
FDLKQTLTRLMTHLFGDELEIRWVDCYFPFTHPSFEMEINFHGEWLEVLGCGVMEQQLVN
SAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKY
PAVINDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYRITYRH
MERTLSQREVRHIHQALQEAAVQLLGVEGRF
Download sequence
Identical sequences G2HF49
NP_001233392.1.37143 XP_009448696.1.37143 XP_009448698.1.37143 XP_016810107.1.37143 9598.ENSPTRP00000030207 ENSPTRP00000030207 ENSPTRP00000030207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]