SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2JC86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2JC86
Domain Number 1 Region: 24-67
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000398
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2JC86
Sequence length 73
Comment (tr|G2JC86|G2JC86_CLOTH) Uncharacterized protein {ECO:0000313|EMBL:AEO12408.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_3339 OC=Ruminiclostridium.
Sequence
MKIIEDENSGEVVIDNIRIEGFIYDEKCKKCNNFLVYYEKYDAFFCAYCNEWVESKCRDK
ECEFCKSRPEKPL
Download sequence
Identical sequences G2JC86
2005471078 WP_020458076.1.31213 gi|346980504|ref|YP_004849448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]