SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2WCH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2WCH8
Domain Number 1 Region: 116-386
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.25e-46
Family WD40-repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G2WCH8
Sequence length 401
Comment (tr|G2WCH8|G2WCH8_YEASK) K7_Hat2p {ECO:0000313|EMBL:GAA22771.1} KW=Complete proteome OX=721032 OS=yeast). GN=SYK7_018231 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI
IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE
ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS
DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA
NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN
LEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL
NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDIIS
Download sequence
Identical sequences A0A250WJH2 A6ZQP5 C7GXE3 G2WCH8 N1P3J0 P39984
4932.YEL056W tr|A6ZQP5|A6ZQP5_YEAS7 YEL056W NP_010858.3.97178 YEL056W YEL056W YEL056w___KOG0264 YEL056W YEL056W YEL056W YEL056W YEL056W YEL056W 355030 YEL056W YEL056W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]