SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2WFA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2WFA7
Domain Number 1 Region: 83-333
Classification Level Classification E-value
Superfamily vWA-like 2e-32
Family Trunk domain of Sec23/24 0.001
Further Details:      
 
Domain Number 2 Region: 508-626
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 5.23e-20
Family C-terminal, gelsolin-like domain of Sec23/24 0.0035
Further Details:      
 
Domain Number 3 Region: 18-56
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.00000144
Family Zn-finger domain of Sec23/24 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2WFA7
Sequence length 630
Comment (tr|G2WFA7|G2WFA7_YEASK) K7_Yhr035wp {ECO:0000313|EMBL:GAA23750.1} KW=Complete proteome OX=721032 OS=yeast). GN=SYK7_031461 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MCSPTNFLYEPFSSDAVTQNYDQNLKCTKCGAYYSMACSLREQNVWTCLFCNQSNSNAEL
PLVPSNTYTLTSAKKEILSRRTIMIIDAICDPHELNYLVSILCNNYITRQQEPLSIITIQ
QSGHVILHNAVNHKRDAVFSINEFMTKYNLDKLNASYFEKKISEINQESYWFDKSTQGSL
RKLLREICKIANKANISSKRDKRCTGLALFVSSVLASQCSLSAYCHIVSFLNGPCTKGGG
KVMSRERGESIRQNHHFESKSSQLQLSKSSTKFYKKMLEKFANQTLIYEFFIASLDQIGI
LEMSPLITSSMAVSQFDSFNDERFAMSFQKYLNLRDHNAIYNCHSKIMTAKNAIVVKDFP
KYSLNPKNLSLPLEISLGHNSAEAPIQFQTTFENRTDKYIRIETLLLPKANGSFGAQNEI
VFSMKTIASRIIDSFAYSSKHTKELMKQLFLLPNQIRGKDVDMVNLIQWCYHIYRSPILS
VRNTSPDERYLFLHRIINASKDTCLSLCKPFIWSYSDLKHDWIVLDVPLTRAQILQDDKT
TICVDGGSYLVLRRGKLLEKEGRELCCKLLNDLQRFPQPLYVETKTGGSQDRFLKSKIIP
LDITDKETLGTEDMTFNEYFNLFTDLSGSK
Download sequence
Identical sequences G2WFA7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]