SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2WI77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2WI77
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.83e-41
Family YKR049C-like 0.000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2WI77
Sequence length 133
Comment (tr|G2WI77|G2WI77_YEASK) K7_Fmp46p {ECO:0000313|EMBL:GAA24770.1} KW=Complete proteome OX=721032 OS=yeast). GN=SYK7_044121 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSFWKTLQRQPRTISLFTNDIASNIKSQKCLQLLKGDVSHRFDVEIANRFPTWDQLQYMR
TSCPQGPVSLQRQIPKLDSVLKYKHTDPTFGMDLQKCVQRGLWNPKEALWVDWENKLVGN
EPADIDKYIIQRK
Download sequence
Identical sequences A0A0L8VLN6 A0A250WJB8 A7A009 B3LRC8 C7GNL6 E7KF55 E7NK70 E7Q6F7 E7QHH2 G2WI77 N1P2Q0 P36141
SCRT_04065 1wpi_A YKR049C YKR049C YKR049C YKR049C YKR049C YKR049C YKR049C YKR049C tr|A7A009|A7A009_YEAS7 YKR049C 000011356|e1wpiA1|2485.1.1.15|A:1-133 cath|current|1wpiA00/1-133 d1wpia1 YKR049C YKR049C APC6384 YTYst250 YKR049C YKR049C YKR049C 4932.YKR049C YKR049C YKR049C YKR049C NP_012975.3.97178 1wpiA YKR049C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]