SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2WKA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2WKA9
Domain Number 1 Region: 33-580
Classification Level Classification E-value
Superfamily TPR-like 1.71e-80
Family HAT/Suf repeat 0.000000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G2WKA9
Sequence length 677
Comment (tr|G2WKA9|G2WKA9_YEASK) K7_Rna14p {ECO:0000313|EMBL:GAA25502.1} KW=Complete proteome OX=721032 OS=yeast). GN=SYK7_053611 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSSSTTPDLLYPSADKVAEPSDNIHGDELRLRERIKDNPTNILSYFQLIQYLETQESYAK
VREVYEQFHNTFPFYSPAWTLQLKGELARDEFETVEKILAQCLSGKLENNDLSLWSTYLD
YIRRKNNLITGGQEARAVIVKAFQLVMQKCAIFEPKSSSFWNEYLNFLEQWKPFNKWEEQ
QRIDMLREFYKKMLCVPFDNLEKMWNRYTQWEQEINSLTARKFIGELSAEYMKARSLYQE
WLNVTNGLKRASPINLRTANKKNIPQPGTSDSNIQQLQIWLNWIKWERENKLMLSEDMLS
QRISYVYKQGIQYMIFSAEMWYDYSMYISENSDRQNILYTALLANPDSPSLTFKLSECYE
LDNDSESVSNCFDKCTQTLLSQYKKIASDVNSGEDNNTEYEQELLYKQREKLTFVFCVYM
NTMKRISGLSAARTVFGKCRKLKRILTHDVYVENAYLEFQNQNDYKTAFKVLELGLKYFQ
NDGVYINKYLDFLIFLNKDSQIKTLFETSVEKVQDLTQLKEIYKKMISYESKFGNLNNVY
SLEKRFFERFPQENLIEVFTSRYQIQNSNLIKKLELTYMYNEEEDSYFSSGNGDGHHGSY
NMSSSDRKRLMEETGNNGNFSNKKFKRDSELPTEVLDLLSVIPKRQYFNTNLLDAQKLVN
FLNDQVEIPTVESTKSG
Download sequence
Identical sequences A0A250WEW4 A6ZMC0 B3LLV4 E7QJ65 G2WKA9 H0GKY4 N1NX83 P25298
YMR061W YMR061W YMR061W 4932.YMR061W YMR061W YMR061W 354958 NP_013777.1.97178 YMR061W YMR061W YMR061W YMR061W YMR061W YMR061W YMR061W tr|A6ZMC0|A6ZMC0_YEAS7 SCRT_01953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]