SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2WLS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2WLS3
Domain Number 1 Region: 7-249
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000916
Family WD40-repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G2WLS3
Sequence length 357
Comment (tr|G2WLS3|G2WLS3_YEASK) K7_Ynl187wp {ECO:0000313|EMBL:GAA25915.1} KW=Complete proteome OX=721032 OS=yeast). GN=SYK7_059741 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MEKKVICQDIFWSCDGTSFVSVHNDFGIRQYLVPEEGNTDKLNRNLLLPFTRFFRNQSIV
SCAIDPFYSLYNENSDRLAGDRIVVGGKNFPLQLYSLMDGQCILSYDTMNKINGEYETVY
SVKIDVESRVYTGSCRNKVAIYDKSRRDAVWVNQSTKKASKGRQSIISCFEEQPMGGQAL
SRGSLLCGSYANEMFQVDCRHQRLERLNYTRTVAGGIVQILTSDNGRYVYVVRRNSDAIS
IYDRRNLQHELNVLRLPFRIHHNSAKLKAYIDTAYGLSMGTPQGTILNWGRDLVEFGGVP
SHNSVEDPLITSIPPESEWRTNLDSTIPATVVKNCPGDPELFALSHGGTISLCRFGG
Download sequence
Identical sequences G2WLS3
YNL187W YNL187W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]