SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2WNX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2WNX5
Domain Number 1 Region: 120-154,188-256
Classification Level Classification E-value
Superfamily TPR-like 0.00000000696
Family Tetratricopeptide repeat (TPR) 0.058
Further Details:      
 
Domain Number 2 Region: 4-67,111-154
Classification Level Classification E-value
Superfamily TPR-like 0.00000242
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G2WNX5
Sequence length 640
Comment (tr|G2WNX5|G2WNX5_YEASK) Signal recognition particle subunit SRP72 {ECO:0000256|PIRNR:PIRNR038922} KW=Complete proteome OX=721032 OS=yeast). GN=SYK7_068861 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MAKDNLTNLLSQLNIQLSQDEHSQVEETCVKLLDSGCENPADVFRRCLVAVIQQDKYQKA
LHYLKKFKHIDDKYGRKFALEKLYIFYKLNMPDEFNTLYTAIITDDLDTVLKKDIESLRG
ILHVRAQYCYKNGLYQEAFKIYQHLASHNEKDQDSQIELSCNERVPLSVATELMNRSPLV
TAMDESSYDLLFNESFIMASVGKYDKAIELLEKALQGATNEGYQNDINTIKLQLSFVLQM
VGKTAQSKEILKGLLQELKADSPFSLICQNNLNAFVDFSKYNTNFNLLLRELNVEKLNTF
NLQTFTHEQWSNIQRNVLFLRLFNNVKIHSQESLLSRTFDKYSKLVDNVTLESYKTQAKK
LYHHTTKTILSGTDGSTIGILLLTIQLLIIEKEWENAIRIGELFLNESWKSSFEKFNDSQ
AIVCYILFELYKIKGRNNSKSVLLKKLGSVRVQLSGKIQENIPFWKHVGFELLSMGNAKE
SKALLREISNFSKGDADVLVDRVVSSDSLDIAQGIDLVRDIDIDKLIQLGVKPLESSAKR
SKNTAVSKVQKRKVLELKKKRKIKRLEKFLQGRDTSKLPDPERWLPLRDRSTYRPKKKQQ
GAKQTQGGAMNKKSEQALDISKKGKPTVNKKPKNKKKGRK
Download sequence
Identical sequences A0A250WCT4 G2WNX5
YPL210C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]