SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3KGW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3KGW8
Domain Number 1 Region: 146-281
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.57e-21
Family Pentapeptide repeats 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3KGW8
Sequence length 302
Comment (tr|G3KGW8|G3KGW8_ADIVA) Pentapeptide repeat family protein {ECO:0000313|EMBL:AEN94425.1} OX=104782 OS=Adineta vaga (Rotifer) (Callidina vaga). GN= OC=Adinetidae; Adineta.
Sequence
MRISVGNSVQMAKKLNRLTLVKLFFSALIPLTIGLFTVITTIQQQKSSTAQREQDKQDAL
LLRQQSDLQAENLHKEKVYATYLDDVSELFTMNNSKDTLMKIRAKTLATLRQLDMDRKKH
LLLFLYDSELIYHSPEKTISSVLRVDEADLNGVYFRGTVDASCSFMYLYLHYVYLSNASF
INCFIDRSNFSFSIMYKTVFTKTRFLRTSFRFALLGKADFSLATFFEMDFIGASLVECNF
TGARWVKKNTDFIGTNLTGAIISNELLKKSKLYNSILPNGTWGPILGRNLVVNGNAERNV
SI
Download sequence
Identical sequences G3KGW8
GSADVT00059855001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]