SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3MY28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3MY28
Domain Number 1 Region: 15-177
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.85e-24
Family Bacterial PLC 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3MY28
Sequence length 177
Comment (tr|G3MY28|G3MY28_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000054454} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
VNTKIKVQACVCHVNANWMLVLSSQLWDMPSHHLSIPGSHSTMTYCLNKKSPISHKESRL
LQTLGKVLPCVTLPVVLKRSTTQTFQCAEHREAPGCWREDLQMAHMEEGTERNLHSGHMV
YMTALTEDMLTEISEWLENHPQEVVILACRNFKGVMEDLHEYLMGCIKNIFGDMLCP
Download sequence
Identical sequences G3MY28
ENSBTAP00000054454 ENSBTAP00000054454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]