SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3MYT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3MYT6
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.36e-58
Family Dual specificity phosphatase-like 0.0000017
Further Details:      
 
Domain Number 2 Region: 125-333
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.8e-46
Family Dual specificity phosphatase-like 0.000000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3MYT6
Sequence length 626
Comment (tr|G3MYT6|G3MYT6_BOVIN) Cell division cycle 14A {ECO:0000313|Ensembl:ENSBTAP00000054725} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CDC14A OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMV
YRYCCKLNKKLKSYSLSRKRIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLS
GSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDF
NWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDA
GFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFT
HAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSSLD
DMSIGGNLSKIHNMERFGENNLEEDEDVEMKNNITQGDKLRALKSQRQPRTSPSCAFRLE
DMKGHPRAVSQPSRLGSSPQGSASPLKTSKVALSPSVTAKRINRGSVSSGASVRSFSINS
RLASSLGNLNAAADDPENKKTTSPSKMGFIANPFTNLLNGSSQPPARNYPELNNNQYSRS
SNSSGSAPSSQPGPHGAKTTEEHSTALRPSYTGLSSSSARFLSRSIPVSSQTTPPLGPQN
PELNFCALPSQPRLPPKKFNSAKEAF
Download sequence
Identical sequences G3MYT6
ENSBTAP00000054725 ENSBTAP00000054725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]