SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3MZ92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3MZ92
Domain Number 1 Region: 10-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-20
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3MZ92
Sequence length 280
Comment (tr|G3MZ92|G3MZ92_BOVIN) Calponin {ECO:0000256|RuleBase:RU361224} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
TSAGPRSQLSVKDGINLCELMNKLQPGSVKKVNESSLNWPQVENISKFIKAIQAYGRHIK
PRDVFEGNDLFENGNLVALAGVAKTKGFHTTIDIGDKYAEKQTRHFDEGKLKAGQSVISL
QMGTNKTSQAGMTAYGMRRHLYDPKMQTDKPFDQTTVILQMGTNKGGSQAGMLALGTRKD
IYDQKLTLQPMENSTISLQMGTNKVASQKGMSVCGLGWQLYDPKYCAAPTEPVIHNGSQG
TGTSGSEISDFQAEYSDEYHGQYQDDYPEVIRNDDQGTDY
Download sequence
Identical sequences G3MZ92
ENSBTAP00000054887 ENSBTAP00000054887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]