SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3MZK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3MZK7
Domain Number 1 Region: 9-106
Classification Level Classification E-value
Superfamily EF-hand 1.21e-27
Family Calmodulin-like 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3MZK7
Sequence length 106
Comment (tr|G3MZK7|G3MZK7_BOVIN) Troponin C2, fast skeletal type {ECO:0000313|Ensembl:ENSBTAP00000055007} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TNNC2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAI
IEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKTEEELAECFRIFDR
Download sequence
Identical sequences G3MZK7
ENSBTAP00000055007 ENSBTAP00000055007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]