SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3MZM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3MZM0
Domain Number 1 Region: 35-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-35
Family SCAN domain 0.0000449
Further Details:      
 
Domain Number 2 Region: 658-715
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-26
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 575-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 714-771
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 920-976
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 519-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 10 Region: 961-1013
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 11 Region: 865-920
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-18
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 12 Region: 825-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 13 Region: 320-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000099
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 14 Region: 621-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000101
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 15 Region: 214-272
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000523
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Domain Number 16 Region: 770-818
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000274
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3MZM0
Sequence length 1016
Comment (tr|G3MZM0|G3MZM0_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000055020} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZKSCAN8 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
IPRWNWHGRRLRRQGVISEEDHGWDQESSLHENNPPGQELFRLRFRKLCYQETLGPREAL
IQLRALCHQWLRPDLNTKEQILELLVLEQFLTILPEELQTLVKEHQLENGEEVVTLLEDL
ERQIDILGRPVPARPHGHRVLWEELMHSESAPEPPDTQLQPVAMQHKSAVLQGPHDRGEE
PDFTAEEGGSEKSPTPSQKGSPRDQEMTATLLTAGFQTLEKIEDMAVSLIREEWLLDSSQ
KDPSRDNRPENYRNMFSLGGETRNENRELTSKQVISTGIQPHGETAAKCNGDVIGGLEPG
EARDLLGSLERQRGNPTQERRHKCDECGLVRHWRIHTGEKPYQCNVCGKAFSYRSALLSH
QDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQCGKAFSQSAGLILHQRIH
SGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGHQRSHTGEK
PYKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIHTGEKPYQC
NECGKAFIQRSSLIRHQRIHSEERRYTCSECGKKFAQSSGLVRHQRIHTGEKPYECDHCG
KAFSVRSTLTVHERIHTGEKPYACNECRKAFSVRAHLIIHQRIHNGEKPYECNECGKAFS
VSSDLIKHQRIHSGEKPYECDECGKGFSVSSALIKHQRIHTGEKPYECKECGKAFYVNSA
LINHQRIHSGEKPYKCGECRKAFSQISTLIHHQRIHTGEKPYECDECGKAFRGSSNLTKH
QKIHAKGKQEPYLCHECGKAFKFCDSLAKHQRIHKHQKVNPTRVKRHKCKECGKAFSQSS
GLVQHWRIHTGEKPYKCNQCGKAISYKSALLSHEEIHNKIKCYQCNECGKAFSQNTSLVL
HQRIHTGKRPYGCKECGKCFSQSSHLIGHLRIHTGEKPFKCNECERAFTQRSGLMEHQRS
HNGEKPYMCKECGKTFRGSTSLTQHLRIHTGEKPYQCEEHGRAFIQRSNLVCHQRI
Download sequence
Identical sequences G3MZM0
ENSBTAP00000055020 ENSBTAP00000055020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]