SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N0E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N0E6
Domain Number 1 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 332-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 389-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 24-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 430-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 143-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000276
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3N0E6
Sequence length 491
Comment (tr|G3N0E6|G3N0E6_BOVIN) Zinc finger protein 772 {ECO:0000313|Ensembl:ENSBTAP00000055306} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF772 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
PVALQPLAFPSPQVPMAAAVLTDPAQGNVTFEDVFVSFSQEEWGLLDEAQRLLYREVMLE
NFALMASLGYASSMSHGVSPQELGREPWVSDWANTIPALTREAQSAGSPGCWHGMEDDEI
RFEQSISIKRVSKGMIPKTIPSSQKAHPCETCGPILRDVLHMAEHQETRPGQKPYLCVAC
GKQLWFSANFPLHNQHSGEKPHRRDVHRALLVSSCPVQSSETPFTTGEGCEDFPTSSSMF
QQHYPLSKWKPQSDTHCAEVFHSGQKHYECSECGKAFSRKDSLVQHQRVHTGERPYKCSE
CGKTFSRKPILAQHQRIHTGEMPYECGICGKVFNHSSNLIVHQRVHTGARPYKCSECGKA
YSHKSTLVQHESIHTGERPYECSECGKYFGHKYRLIKHWSVHTGARPYECIACGKFFSQS
SDLIAHQRVHNGEKPYVCSECGKAFSHKHVLMQHLRIHTGERPYKCSECGKAFRQRASLI
RHWKVHAGERP
Download sequence
Identical sequences G3N0E6
ENSBTAP00000055306 ENSBTAP00000055306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]