SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N0F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N0F4
Domain Number 1 Region: 20-286
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.14e-82
Family Eukaryotic proteases 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3N0F4
Sequence length 314
Comment (tr|G3N0F4|G3N0F4_BOVIN) Protease, serine 21 {ECO:0000313|Ensembl:ENSBTAP00000055314} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PRSS21 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MRPQGAALLLAQLLVRIEIAEQAAQPGVRLSIPGPCGQRVIPTRIVGGKDATIGHWPWQG
SLRLWGYHFCGASLLNRRWALSAAHCFENNRNPFHWSVQFGELSAAPSIWNLQAYYNRYN
VDQIFLSPHYLGAPVYDIALLKLSSSVTYTKYIQPICVMASISEFENRSDCWVTGWGDIE
EELSLPSPYTLQEVQVGIINTTMCNHLFSMPDFRIDIWGDMICAGEPQGGKDSCFGDSGG
PLVCEKKGLWYQVGVVSWGVGCGRPNRPGVYTNISVHYKWIREVLAQNNTCRLDSCLMLL
LLPLLWALPFLQLA
Download sequence
Identical sequences G3N0F4
ENSBTAP00000055314 ENSBTAP00000055314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]