SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N0P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N0P8
Domain Number 1 Region: 966-1094
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000641
Family GAF domain 0.021
Further Details:      
 
Domain Number 2 Region: 236-290,801-847
Classification Level Classification E-value
Superfamily EF-hand 0.0000104
Family Calbindin D9K 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3N0P8
Sequence length 1440
Comment (tr|G3N0P8|G3N0P8_BOVIN) EF-hand calcium binding domain 5 {ECO:0000313|Ensembl:ENSBTAP00000055414} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=EFCAB5 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
DLNLENQPKMSTCSIKESKTRGSKNIVFRKPAKVIFSLDQTAQDSNREQPWKKNLLERVQ
ARAQVMHQKIIDKENLKKELEKKEEEKLPRDNLAKEWFNTENMTLNTRAYLLDKLLPTLV
PGMERMLMQVEKKKLLADVDIPTKFDPINHLGEYLMRNNPNYIKDSGLSGYQRVMREISE
DLKIYVPNTTYNRVSKIKENIKQKREQKEYINDIKAKVANARKQALQEQFNEWILDPKGM
IPMVVIQNVLYEFFQNPDLQLETCCLPVDIADSMKPRLNKTEFIQLISLHIAGFKSETFE
KLLKHLCHCAAEFREVIKTDMRRQMFADLFLHCDRGKVGFLDRQRTLALLETFYDQSSKV
LRGTLRNPRQWPFVEFGEIDLPEFWGDMDNQKHIYEDFDNVLLEMNTLPSEKHFSKTQSK
LLASPEDQHEHYRESTLPQSPPEQQRGATVEQGPNGISTREQEQPEESTGEQELNEESVS
KEGTYTGSTPEQRSSRELITEQRPHHEPITEQGVPQGTHIESTAEQGLSEESITTEGQHE
GSTTGQGSHGKSTEEQGSRRESQSDQGQPRETMAEQEAHRESQSDQGPHGGETILEEQQD
TDLTSQSRKGSLTGESKTSRESISFEHTEIPPQEGRTQAHAYEELLFVSPELQAKTGVSI
PEDHLSEPAKKEVQKDKSCEPKSQKIEGKSWTGELLTCNWNMKYAKHEDEEQAHLIYDNS
RFTDLHSIIRNIQSYKEIKGRSTFNGVSVNLLQFVQLLETFVGEDSPLSVSEALTSFFRK
GFVETKEEKMSGLEKARQNASRIRRELLLKALFQKWDCDGSGFLDLKEIDELLYTYKEGM
EKESMKKAKLHVQFPKLHPGHEVRLSSKQFQKYIELVVSELRGNEEEVLESVVEFLMNSL
ERSHVESLRNCARQKWLHQIQRAAETSGVSLEPVYTETFKALTQDAEAHGNKKISAHISL
LEENLLLPDRGNVLLRNVACTLDDAPFVLKRVLYRDMKGISFTVVDEGKPIHVPQVQHHG
NIYFWNHSRKKSDHNGSFLALPLQDAYMRIFGVLAVDTLRDPQKINIFLPHEIRFYQGVA
NVFSTAYHYVHSREHILHIVITGIGWLYNITPSITAISTYFVEPNSEKDSDYVLRNMMVT
GQQGLTEIHKNPSVIFRKTCIFRDFLFKCTDSSGVVLASVCGENHIVVPLRERTGEALGV
LDVNIGKSKMLLYREFKDLQKMLKVIQLACSEILGEFSGEIKKNYILEIESVGEVQRAGI
LFFRVMLQELQECLSLLTSSDFVSLLLHDYDPLAEVKAPPDSQSQDLKANIKLVQDILKG
IIVFFHPELKSSSDLESWDHCKLYVNQQLVENICDFDPTAMELKVNLRLIAEYFESTDHS
RIEVWKFGNSAIEYLYHWAHICLALIKLNKKISGAIPPPLPSKTDSCVYAKMPGGSLPGK
Download sequence
Identical sequences G3N0P8
ENSBTAP00000055414 ENSBTAP00000055414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]