SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N1Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N1Z0
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000031
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3N1Z0
Sequence length 119
Comment (tr|G3N1Z0|G3N1Z0_BOVIN) Allograft inflammatory factor 1 like {ECO:0000313|Ensembl:ENSBTAP00000055894} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=AIF1L OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
EFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKM
ISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANEGSSKPVGPPPERDIASLP
Download sequence
Identical sequences G3N1Z0
ENSBTAP00000055894 ENSBTAP00000055894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]