SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N2F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N2F5
Domain Number 1 Region: 316-409
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000327
Family Calponin-homology domain, CH-domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3N2F5
Sequence length 414
Comment (tr|G3N2F5|G3N2F5_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000056067} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAIHLDEQKIIVKNEKDTSSVKAESKSLLASRKTGLPSTAPSKFSDAEPAKRRLFVGMEI
IPEGLKSGKCEMPKKGNRSLKNEAKDKEFFSPKEGTRTYDFFLKTVNAAQTWFSLFGWPE
GPHSLNIPETVRRDVYKIQVYSSALSARKFSRQSDFSKYNKTIYDVLIHLCGKMPPGINS
SQSLPVDYPERVIQLHWQHSLLLDFLSAQGACISHVLPEFLLEPEDYKKWIEIRSSTTIS
AKFSHIPKGKHSVVIDMTDFEVWSKRSWTDVFLQIYKVLVLSRIVPYSINNLPPVYMQNS
PKVNAYFASSNIYSDSERILLSWMNTNYENARHVIWKNCQKGVIPPERWIVNFDKDLLDG
LVFATVLGAYCPFLIESHFINMYTQPKSSEQYLHNCLIVVNVLHEIGFDMDIQV
Download sequence
Identical sequences G3N2F5
ENSBTAP00000056067 ENSBTAP00000056067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]