SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N3M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N3M7
Domain Number 1 Region: 54-137
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000451
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3N3M7
Sequence length 138
Comment (tr|G3N3M7|G3N3M7_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000056532} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MVTWVAVVTLSVDLGLAVGVVFSMMTVVCRTQRVQCLALGLAEGTELYRPLRESHKLLQV
PGLCILSYPAPLYFGTRGQFHRVLEWHLGLGEGRKEAPKTDGPPDAAAEPVRVVVLDCSG
VTFADAAGAREVVQVRER
Download sequence
Identical sequences G3N3M7
ENSBTAP00000056532 ENSBTAP00000056532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]