SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3N3T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N3T9
Domain Number 1 Region: 77-257
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-54
Family F-box associated region, FBA 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3N3T9
Sequence length 260
Comment (tr|G3N3T9|G3N3T9_BOVIN) Non-specific cytotoxic cell receptor protein 1 homolog (zebrafish) {ECO:0000313|Ensembl:ENSBTAP00000056600} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=NCCRP1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MEEVREGPELGGGMEEPASPQEPASPPPPPSPPSPAAPETPRLPAPESPTEAHARQLLLQ
EWAPPRGSLELPPRLTWKLLFLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQQPLEALGN
FRGWHIRTEKLQQNLSWTVKQQCVDLLAEGLWEELLDDEQPRITVMDWFEDSRLDACVYE
LHVWLLAADRSTVIAQHHVAPRTSGRGPPGHWIQVSHVFRQYGPGVRFVHFLHKTKNRME
RGGLRRTRVTDSSVSVQFRE
Download sequence
Identical sequences G3N3T9
XP_002695095.1.76553 XP_006068734.1.26621 XP_597250.2.59421 ENSBTAP00000056600 ENSBTAP00000031988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]