SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N3V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N3V6
Domain Number 1 Region: 55-92
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000774
Family Classic zinc finger, C2H2 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3N3V6
Sequence length 1348
Comment (tr|G3N3V6|G3N3V6_BOVIN) Zinc finger protein 804B {ECO:0000313|Ensembl:ENSBTAP00000056619} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF804B OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MACYLVISSRHLSNGHYRGIKGVFRGPLCKNGSPSPDFPEKEKSTAKALEDVKANFYCEL
CDKQYHKHQEFDNHINSYDHAHKQRLKELKQREFARNVASKSWKDEKKQEKALKRLHQLA
ELRQQSECVSENGPAYKASKVPIEKQLQQGIFPVKNGRKVSCMKNALLLKGKNLSRSIAD
KQRSTTANRHQLQTDRRRLFGNRVPQTSSDLSNANQRTGVSFSFSKKVHLKLESSASVFS
ENTEETHDCNKSPIYKTKSTAEKCMCCRFANEDTHLTKEKDINISSNHLESILHNTLPIN
SQILQDKNDFVDEMLENSIGIHASFSKSNIHLSDVDFTPSSRAKETRNTLKNTSENRISH
SCQANVSSSPTNIYKHSDARVFGCLGEIPSIEPSEQSSSVHLNPNSRKQKREKSLDKTER
VSRNAQSFIREAYPHDVKAKALPFLHVKSKDGHTTLQWPTELLLFTKTEPCISYGCNPLY
FDFKLSRNTKDGRDPEDLKTELQKEASEMKTTMENQVSGLIKDQQKLIQEDNRSLKPKMK
IANPDWENFQRKYNLGGNNSEPSMSERNFSASDLEMKNPEVPAYLDISLKNCVGNNKNGG
NELQEPSRAHWQSCQRVILNDANKGLSFSPCTSRTKKHKLISCDPHLDVEEVNQFTWKSS
PYTIRDHSDHGKDFSVILNSNYISTTSGVSGCGRASYKISSPKVSLNRCSSPSDTSHVST
SSLRSSHSNYGSSGHDRGNLLYFCKREHNSVERHKRKRRKHSCFCFSEELAKSDCPQSET
ERGRSCKLWESIKNEKYSKHAYGYCREKHKLGKNQQFSGQKSKRITQCDFSSQVFCAGNS
ENPPNCQGPQHSRLGSHSREKMYYLNKSKMNQQSLDSPHICDLGKVKPMQCNSGNISYLL
RNCSRSPSDTTELNPIEGERTSLTAKSLLERVQAKKCQEQSIQFEISSNSCKNESETLSQ
IQCVIPFTPPGCNRPSLPLPEKTPNKGRRRKDKGSAMQRSIDKNKVKSSPTNDFTVLVGT
DCDNHFSKGIIHVVAESHSPNMKKNPTTKEQPKSLINEVQPSIQSCDPVPNGFPGAFPSN
RYSGITDSMETKENDMNLDLQDGSMQMNQIEGNINSYYDRTMQKHDKVADDLEVCHKSLS
PPLIQQPITYSPDEIDKYKLLQLQAQQHMQKQLLSKHLRVLPAAGPTAFSSASTVQTVPG
HQQASITTIHHTFLQHIVSASINAHSSHLPIAHLHPLSQPRFNPFTFSPLTPTIIPAHPT
FLAGHPLHLVTTAPFHPSHITFQPLPPAAFIPTLFGPHFNPATTSIIHLNPLIQPVFQGQ
DLCHHSCSSQMQPLNGVKEALNVSARLN
Download sequence
Identical sequences G3N3V6
ENSBTAP00000056619 NP_001178432.1.59421 NP_001178432.1.76553 ENSBTAP00000056619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]