SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N488 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N488
Domain Number 1 Region: 636-736
Classification Level Classification E-value
Superfamily Bromodomain 4.84e-28
Family Bromodomain 0.00049
Further Details:      
 
Domain Number 2 Region: 270-344
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.86e-18
Family PHD domain 0.0095
Further Details:      
 
Domain Number 3 Region: 1126-1239
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.43e-18
Family PWWP domain 0.014
Further Details:      
 
Weak hits

Sequence:  G3N488
Domain Number - Region: 382-422
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000158
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3N488
Sequence length 1255
Comment (tr|G3N488|G3N488_GASAC) Bromodomain and PHD finger containing 1 {ECO:0000313|Ensembl:ENSGACP00000000108} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=BRPF1 OC=Gasterosteus.
Sequence
MGLDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPTPAQTLPQKR
RKGRPPRASLAGSGSPNRSDHSHSPGRETMTYAQAQRMVELEFQGRLHRISIFENIDVVS
EEDSGAEDAPQSGGGGGKERPDIPSSNGGKSTPKSGKHKSKEKKKDGSSHHHSAQSGPAV
KLPEAVFRELDQERPDAPSRPSSYYRYIDKSVEELDEEVEYDIDEEDYIWLDIMNDKRRR
DGVTPIPQEVFEYLMDRLEKESYFESHNKADPSTLIDEDAVCCICNDGECQNSNVILFCD
MCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDARWAHVVCA
LWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCA
QQAGLYMKMEPVRETGANGTSFSVRKTAYCDIHQGCASMGSSHSDGELEDDDEPSICQDD
DSKGWSSERAKRAKAKSRLKMKRARKILAERRAAAPVVSVPCIPPHRLSKITSNLTVPRK
SQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRHVELVQRDGEEKASALKEQLKAWQR
LRHDLERARLLVELIRKREKLKRETIKVQQMALEMQLTPFLVLLRSTLEQLQERDINNFF
TEPVPLAEVPDYLDHIDTPMDFQTMWNLLESHRYLTFEAFESDFGLIVNNCLKYNAKDTV
FYRAALRLREMGGAVLRTARRHAERIGFDYEAGVHLPREPSPDSQRDQDDRPLSSNEDDL
LLPENRRRLPLEEQLHYLQARLDEVSLGKHSIGQSRRAKALRKEISIVKRKLAHQREGGA
GLGGRESAGGGDRGSSLPHHPSSSGHHDEGGESSSQEIGGKDMSVSSSALAPEVGRRTSV
LFSKKNQKMAGPPKRPGRPPKNRDAVYAAAALGQSPIGPPQLPLLSPSRQRKRPRSPRTS
SSSDSDSDDDDLLPASGLPSNGFDGGNQPVTESFRVYRSESRLPRSSSDSESTTSSSSSA
ASDRTSTTPSKQGRGKASFSRSAFPEDSSEETSGTENDSYSVGGPRSVSHSSAASGGSQA
GGITTVWATTRPTRPNEPSRLLHCTTTQFSPQRGLKQDLFTSSLEALDLVWAKCRGYPSY
PALIIDPKMPREGVFHRGVPIPVPPLDVLKLGEQMTQEAREHLFLVLFFDNKRTWQWLPR
SKLVPLGVDQELDKEKMLEGRKSNIRKSVQVAYHRAMQHRSKVQGDPSSETSDSD
Download sequence
Identical sequences G3N488
69293.ENSGACP00000000108 ENSGACP00000000108 ENSGACP00000000108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]