SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N4A5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N4A5
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.95e-38
Family Calponin-homology domain, CH-domain 0.00000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3N4A5
Sequence length 312
Comment (tr|G3N4A5|G3N4A5_GASAC) Calponin {ECO:0000256|RuleBase:RU361224} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
QIAQKYDPQREEELRFWIEEVTGMSIGENFQKGLKDGVVLCELINKLQTGSVRKINLSQL
NWHKLENLGNFIKAILAYGLKPNDIFEANDLFENGNMTQVQTTLLALASMAKTKGMDTKI
DIGVKYADKQARHFDHEKIKGQCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTDKPY
DQTTISLQMGTNKGASQAGMSAPGTRRDIYDQKVAQQPLDNSTISLQMGTNKVASQRGMS
VYGLGRQVYDPKYCAPPTEPVIHANGSQGTGTGTNGSEISDSDYQAEFQEDEYPGPYHDD
YSSQYSDQRIDY
Download sequence
Identical sequences G3N4A5
ENSGACP00000000125 ENSGACP00000000125 69293.ENSGACP00000000125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]