SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3N4S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N4S3
Domain Number 1 Region: 15-274,357-397
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.51e-45
Family WD40-repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 283-370
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.8e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3N4S3
Sequence length 411
Comment (tr|G3N4S3|G3N4S3_GASAC) WD repeat and FYVE domain containing 1 {ECO:0000313|Ensembl:ENSGACP00000000293} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
TMAAEIHSRPQTARPVLLNKIEGHSDAVNAAVLIPKEDGVITVSEDRTIRVWLKRDSGQY
WPSIYHTVSSPCSCVSYHHDSRRIFIGQDNGAVVEFLISEDFNKMSHVKTYPAHQNRVSD
LVFSLESEWVVSTGHDKSVSWMCTQSGSMLGRHVFTAWASCLQYDHETQHAFVGDYSGQI
TLLKLEKQTYSTITTLKGHEGSIATLWWDPVQRLLFSGAADHSVIMWDIGGRKGRTLLLQ
GHHERVQAVRYLQLTRQLVSCSADGGMAVWNMDTQREEAPPWLDSDSCQKCEQPFFWNIK
QMWDTKTMGLRQHHCRKCGKAVCGKCSSKRTAFPVMGFEFPVRVCDACFDTVKEEDRTPL
ATFHEGKHNIAHMDMDPSRGLMVTCGSDRIVKIWDVTQVVGCSLATGFSSR
Download sequence
Identical sequences G3N4S3
ENSGACP00000000293 ENSGACP00000000293 69293.ENSGACP00000000293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]