SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N6R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N6R6
Domain Number 1 Region: 154-356
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.16e-51
Family Prokaryotic proteases 0.00000123
Further Details:      
 
Domain Number 2 Region: 392-487
Classification Level Classification E-value
Superfamily PDZ domain-like 8.68e-20
Family HtrA-like serine proteases 0.0036
Further Details:      
 
Domain Number 3 Region: 26-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000926
Family Growth factor receptor domain 0.0019
Further Details:      
 
Domain Number 4 Region: 89-136
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000222
Family Ovomucoid domain III-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3N6R6
Sequence length 491
Comment (tr|G3N6R6|G3N6R6_GASAC) HtrA serine peptidase 3 {ECO:0000313|Ensembl:ENSGACP00000000991} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=HTRA3 OC=Gasterosteus.
Sequence
KMHILLYAAVFLYLKESAFAKPKDKCPTRCDVSTCPSPGCPSGYVPDRCNCCLVCAQAEG
EPCGRKDDLPCGDALECKHPAGKRLSKGFCRCRFRQDVCGSNGKTYGNVCQLKATSRKAL
QQGLPAFNLAHKGPCDNSTASIGPSHADSPRYKFNFIADVVEKIAPAVVHIELFLRHPLF
GRNIPLSSGSGFLLSDNGLIVTNAHVVSSTTPVSGQQHLKVQMHDGHVYEANIKDIDKKS
DIATIKINSQMKLPVLFLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGKELGL
KDSDMDYQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPADRITLFLNDSLDK
HNKGVSDSDVIGPGLNIFKLESLSDVRSIKKRFIGISMLTITPALIEKLKQQNLDFPDVT
SGIYVHGVIPHSPAQKGGIKEGDIIVKLNGKSLMATADLQEALQEETALLLEVRRDNDDL
LFNIEPDVIMQ
Download sequence
Identical sequences G3N6R6
69293.ENSGACP00000000991 ENSGACP00000000991 ENSGACP00000000991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]