SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N7T8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N7T8
Domain Number 1 Region: 647-898
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-53
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3N7T8
Sequence length 930
Comment (tr|G3N7T8|G3N7T8_GASAC) Dual serine/threonine and tyrosine protein kinase {ECO:0000313|Ensembl:ENSGACP00000001372} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MEGNVQQQKTTPLARELTRTFNSYNKHTVQLKKNLKETNAFFREIRQNYSNACASTMSSD
SASFEAGQLSCISFPGHEEEFLRNTVGAAPCILVLGQDCAARYQLLNCLLGERLLPLCLE
AGEACKGVQGSVCKRRKLCFTHGRQTRLSLALPGQYELVHQLAANCGRWDTVPREDLEIH
EECEDPAHRLAELEITLHHPLLQEAKVMVVPCQSVQPIEEALADCTRTVIPILLYAINQD
TLGTDHVAELRKVKEMLSFPICFIRIPDPMPAASPEPGRRGEREKERDREKSALFKQLLS
LGFLSNPVGNCSCGAPTQTSAPGAKPLSLLVEAFERLHRLLVPFTRQVLQNQQVEAANLL
NGVHCRCLDIFINQAFDMQRDLQITPRRLEYTREKEGELFTSLMAIANRKQEEMKEMIVE
TLGSMKEQLLEDAANLEFTADIIVTTNGDPVTSKEIKSCIHQIQELIVVRLNQAVANKLI
SSVDYLRESFVGTLERCLNSLEKSHMDSSVHNITSNHLKQLLNAAYHVEVTFHSGSSVSR
LFWEQIKQIIHRITFVNPPAVSPEWKRKVAQDAIESLSAAKLARSICSQFRTRLNSSHEA
FAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDVLLHGKPKLGRELG
RGQYGVVYLCDSWGGHFPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVDLHGSVID
HTYGGGSSIAVLLIMERLHRDLYTGLKAGLSLRERLQIALDVVEGIRFLHGQGLLHRDIK
LKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFW
YLCTGSVKLPEAFEKCSSKDQLWNNVKKGARPERLPTFDEECWQLMEACWNGDPSLRPLL
GIVEPSLQSIMVRLCNRGSEQKSSSLDDSN
Download sequence
Identical sequences G3N7T8
ENSGACP00000001372 ENSGACP00000001372 69293.ENSGACP00000001372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]