SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N995 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N995
Domain Number 1 Region: 70-317
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.5e-86
Family Eukaryotic proteases 0.0000998
Further Details:      
 
Domain Number 2 Region: 34-85
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000207
Family Scavenger receptor cysteine-rich (SRCR) domain 0.072
Further Details:      
 
Domain Number 3 Region: 4-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3N995
Sequence length 333
Comment (tr|G3N995|G3N995_GASAC) Transmembrane protease, serine 3a {ECO:0000313|Ensembl:ENSGACP00000001885} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
GLSCVGKFHCGSSAKCIRLAKQCDGEVDCDNGEDELGCVRLSGRSSVLQVQRGGAWRTVC
SEGWNNWLGMSACKQLGHSRPQYNTRIVGGNISKPGQFPWQVSLHLNSKHVCGGSIITSR
WVLTAAHCVYGFAYPSMWVVHVGLTEQPTHGAQSLAVEQIIYHTGYESGEDYDVALMKLA
TTLPFNGFVAPICLPNFGEEFEEGTMCWISGWGATEDEGETSVVLRSAVVPLLSTKTCNQ
PQVYQGLISSWMICAGYLEGGTDSCQGDSGGPLACEDSSVWKLVGATSWGIGCALRNKPG
VYTRITQALSWIRQQMEIRYGALFKDVTSLQLS
Download sequence
Identical sequences G3N995
ENSGACP00000001885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]