SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N9J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N9J5
Domain Number 1 Region: 131-375
Classification Level Classification E-value
Superfamily vWA-like 5.56e-80
Family Integrin A (or I) domain 0.000000366
Further Details:      
 
Domain Number 2 Region: 375-460
Classification Level Classification E-value
Superfamily Integrin domains 4.97e-25
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 3 Region: 626-707
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000000641
Family Integrin beta tail domain 0.0035
Further Details:      
 
Domain Number 4 Region: 25-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000732
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 543-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Integrin beta EGF-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  G3N9J5
Domain Number - Region: 585-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000153
Family Integrin beta EGF-like domains 0.024
Further Details:      
 
Domain Number - Region: 505-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000614
Family Integrin beta EGF-like domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3N9J5
Sequence length 779
Comment (tr|G3N9J5|G3N9J5_GASAC) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MDWFLFFLLLQMGRIDIKGASQQEEVCSKSVVNSCDDCIKSGPFCVWCKQLDFTKPGEQE
AVRCDTKAQLTGRGCTEGEIISPQNDQTIDKGESLSESFNNQEPIQLSPQKISLRLRSGS
PNTFKVSFKRVEGYPVDLYYLMDLSYSMKDDLENVKELGKDLFAALKKITEHAQIGFGAF
VDKTVLPYTNTNKEKLLKPCDENDQQCQAAFGYRHVLSMTPKEDDFKNKVTEQFISGNLD
SPEGSLDAMMQAAICGDKIGWRNSSTRLIVLTTDAGFHMAGDGKLAGILEPNDEHCHMDN
NLYTNSAEMDYPSVGQLAVQLEKNNIQPIFAVTKNVEDVYKELSQMIPKSEVGVLSTDSK
NVVKLIESAYNRLSSKVTLTHDNLPDNVQVIYTPKCKHPGPSGETEGVCENVQVGQEISF
DVTVTAYSCMKDKSFTIRPQGIKDTLTVTISTNCECQCSDPGPSGHTHCRGKGNVSCGIC
SCREGSIGQFCECDVGGKDEPALRASCQRHNGTECEGRGDCVCGRCECHTTEGGNSYYGD
FCECDDEHCEKFQNKLCGGNGNCKCGKCECFKSHEGSACQCGVSEEGCRTPNNTVCYGRG
TCKCNRCECKEGYQQPRCQTCLGCTDPCQTKLNCIECLGFESGPFKKNCSEACVSIHHVM
VDQSTIQSKKCHQKDSEGCWINFNLDQLVGEDNYKAEILKQRDCPAPPSIAAIISGSIAS
VALIGILLLMLIKLVIYTKDLKEFKKFEIEKKNSKWTDGVSPMFLSATTTIENPTFTGE
Download sequence
Identical sequences G3N9J5
ENSGACP00000001985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]