SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NA60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NA60
Domain Number 1 Region: 171-293
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000926
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 5-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000104
Family EGF-type module 0.027
Further Details:      
 
Domain Number 3 Region: 46-165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000596
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  G3NA60
Domain Number - Region: 839-888
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0558
Family EGF-type module 0.087
Further Details:      
 
Domain Number - Region: 403-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0695
Family Laminin-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NA60
Sequence length 1158
Comment (tr|G3NA60|G3NA60_GASAC) Multiple EGF-like-domains 6b {ECO:0000313|Ensembl:ENSGACP00000002203} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
DIDECQVHNGGCQHRCVNTRGSYYCECHPGSRLHVDGRTCLAVHSCAVSNGGCEHYCMQQ
SAAHFRCRCKANYVLAEDGKHCKLQNPCADQNGGCVHECRADGGKAHCDCKAGYILAEDG
KTCQDVDECEKEADCAHGCRNTLGSYACVCNAAYELGSDGKHCYRIEMEIVNSCENNNGG
CSHHCQHSTSGPVCSCNHGYRLDDDLKTCADVDECGEQSSCCEQDCTNYPGGYECYCSAG
YRLDNDGCSCDDVDECLASNGGCDHTCQNSAGSFQCFCRRGFRLDEDRQSCIPLEDAIEA
LSSGAAIELPLIQPLLTLMQDYNQPLERYDDYEDDDGELRAESNLAEKFVCLDDTFGSDC
SLTCDDCSNGGKCNSWKNGCDCPAGWMGVVCNQTCPEGYFGKNCSFPSKCKNGATCDPIT
GSCRCPPGVSGDVCQDGCPKGFYGKQCNKKCNCANNGRCHRTYGACLCDPGLYGRFCHLP
CPKWTFGPGCSDECQCVQQNTLQCHRRHGTCVCKSGYQGNTCEEECKPGTYGAGCAKKCS
CPLGVSCNHVTGACQRKCPPGRHGENCDQDCPVGRFGAGCVHPCNCTGSPCDKVSGRCKC
PAGTAGKRCENLCPDGFWGSGCTETCPACENGGVCDKHNGSCNCPSGLMGRLCQNSCPSG
RFGQACQMKCVCENNARCDPVAGRCTCAPGWTGHNCRKGCDAGHWGEDCAETCDCRNGDG
SCDGVTGQCNCEAGYTGTRCHQKCPAGMFGLGCRRRCQCDNNALCDHVSGACTCQVGWTG
TFCEKPCPPGFYGLDCQEKCSCLNGGSCDHVSGLCSCPAGWIGSSCDLTCPTGFYGEGCN
QTCSCRNDGICHPASGQCVCTPGWTGPNCTEACLPGMFGEGCMHHCACAQGTSCHHVSGD
CGCPPGFKGNGCEQICRKGRYGLNCESECQCENGGRCIPSTGACDCPAGFIGASCNITCP
AGRYGVNCARVELCGDGAQNDPVTGRCKCVAGRRGSDCAHGCLPGWFGAECVERCNCSNG
GVCDSVTGGCMCSLGWTGSHCNKECPEGRFGANCQLKCNCQNNSTCDRVTGTCRCGPGYY
GQLCEHGRTGLKCDIECRENRFGPDCAETCQCGNGSQCDRRNGRCSCLHSWIGLTCQEGG
PPRITDSRRGDSQHENSL
Download sequence
Identical sequences G3NA60
ENSGACP00000002203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]