SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NAG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NAG7
Domain Number 1 Region: 141-201
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000249
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 2 Region: 16-77
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000235
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 3 Region: 89-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000737
Family EGF-type module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NAG7
Sequence length 220
Comment (tr|G3NAG7|G3NAG7_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000002312} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
VQAQTVRGAGPISQQAGFKYCFREVKDGQCSSPLPGLRSRDICCQGIGKAWGTTECVLCP
DTTGTTECVLCPDTTGKSNSSCPAGFERDNGMQCVDVNECLQPGLCENGICVNTRGRYSC
VCRAGFILDASHGICISQSVISEEKGQCHRVLGSGRGPTSCSLPILRSITKQICCCSRVG
RAWGPDCQRCPHFGSGGRRSLAHTGPGTGPADSPAAANQR
Download sequence
Identical sequences G3NAG7
ENSGACP00000002312 ENSGACP00000002312 69293.ENSGACP00000002312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]