SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NBZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NBZ9
Domain Number 1 Region: 547-916
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.35e-131
Family Hect, E3 ligase catalytic domain 0.00000000000467
Further Details:      
 
Domain Number 2 Region: 453-491
Classification Level Classification E-value
Superfamily WW domain 0.000000000000126
Family WW domain 0.00062
Further Details:      
 
Domain Number 3 Region: 383-415
Classification Level Classification E-value
Superfamily WW domain 0.000000000000994
Family WW domain 0.0013
Further Details:      
 
Domain Number 4 Region: 348-383
Classification Level Classification E-value
Superfamily WW domain 0.00000000000905
Family WW domain 0.0015
Further Details:      
 
Domain Number 5 Region: 20-144
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000145
Family PLC-like (P variant) 0.0012
Further Details:      
 
Weak hits

Sequence:  G3NBZ9
Domain Number - Region: 487-522
Classification Level Classification E-value
Superfamily WW domain 0.0156
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NBZ9
Sequence length 922
Comment (tr|G3NBZ9|G3NBZ9_GASAC) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MAAASTSRPGGGAQTTEKSQLILKVVSAKPQSPKLPSRPARLSSFVEVTADGLTSETKKT
GKRSGHLELQWNEDLTLNVTPQSRLDLKLWSCHTLRKELLGSATIDLLDTLRTHHGKMEN
VQLSLVLQTENKGSVVAGGELNVCLDGMAVDLGTLPNGSTAADSESRPLYKLHRCQRSAL
CVAFHRGPRSPQEGLARLVTPAYNTSLVAVPTMVKARSPLTDEQGWAGLRKPSQLVLFYF
RCRCHKAQVHAHWVGGGGTETFPTKATGHRKGPRSRFPHSSGADGCSLWCSRRCAGGTVD
GASIARLTGTQFVAGGARCLSQCSAYRQQQQPLPGSGRREQTGSSVAEPTTESLPAGWEQ
RVLPHGRVYYVDHNTKTTCWERPLPPGWEKRVDQRGRFYYVDHNTRTTTWQRPTAESVRN
YQQWQSQRNQLQGAMHQFSQRFLYQPSGAPVENDPLGALPTGWEKRQDNGRIYFVNHNTR
TTQWDDPRTQGMIQEATPAPEEMKYTAEGVRYVDHNSRTTTFKDPRPGFESGSRQGGSPG
AYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNVKPYDLRRRLYIIMR
GEEGLDYGGIARWEWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFI
GRFIAMALYHGKFIDTGFTLPFYKRMLDKKPTLKDLESIDPEFYNSITWVKNNNLEECGV
ELYFAQDMEILGKVSTHQLKDDGENELVTEENKEEYIGLLTDWRFTRGVEEQTKAFLDGF
NEVVPLEWLRYFDEKELELMLCGMQEIDMADWQKNTIYRHYTKNSKQIHWFWQVVKEMDN
EKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFNRLDLPPYR
SLEQLREKLLFAIEETEGFGQE
Download sequence
Identical sequences G3NBZ9
ENSGACP00000002848 ENSGACP00000002848 69293.ENSGACP00000002848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]